SCOPe 2.06: Domain d2ypib_: 2ypi B:

Lineage for d2ypib_ (2ypi B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (8 PDB entries)

8. Domain d2ypib_: 2ypi B: [28462]
   complexed with pga

Details for d2ypib_

PDB Entry: 2ypi, 2.5 Å

PDB Description: crystallographic analysis of the complex between triosephosphate isomerase and 2-phosphoglycolate at 2.5-angstroms resolution. implications for catalysis

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d2ypib_:

Sequence; same for both SEQRES and ATOM records:

>d2ypib_ c.1.1.1 (B:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

Timeline for d2ypib_:

• d2ypib_ first appeared (with stable ids) in SCOP 1.55
  
• d2ypib_ appears in SCOPe 2.05
  
• d2ypib_ appears in SCOPe 2.07
  
• d2ypib_ appears in the current release, SCOPe 2.08