Lineage for d2ypia_ (2ypi A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 64294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 64295Protein Triosephosphate isomerase [51353] (13 species)
  7. 64310Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (5 PDB entries)
  8. 64317Domain d2ypia_: 2ypi A: [28461]

Details for d2ypia_

PDB Entry: 2ypi (more details), 2.5 Å

PDB Description: crystallographic analysis of the complex between triosephosphate isomerase and 2-phosphoglycolate at 2.5-angstroms resolution. implications for catalysis

SCOP Domain Sequences for d2ypia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ypia_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae)}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

SCOP Domain Coordinates for d2ypia_:

Click to download the PDB-style file with coordinates for d2ypia_.
(The format of our PDB-style files is described here.)

Timeline for d2ypia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ypib_