Lineage for d1ypib_ (1ypi B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 115905Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 115906Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 115907Protein Triosephosphate isomerase [51353] (13 species)
  7. 115922Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (5 PDB entries)
  8. 115928Domain d1ypib_: 1ypi B: [28460]

Details for d1ypib_

PDB Entry: 1ypi (more details), 1.9 Å

PDB Description: structure of yeast triosephosphate isomerase at 1.9-angstroms resolution

SCOP Domain Sequences for d1ypib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypib_ c.1.1.1 (B:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae)}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

SCOP Domain Coordinates for d1ypib_:

Click to download the PDB-style file with coordinates for d1ypib_.
(The format of our PDB-style files is described here.)

Timeline for d1ypib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ypia_