SCOP 1.73: Domain d7tima_: 7tim A:

Lineage for d7tima_ (7tim A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (17 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (7 PDB entries)

8. Domain d7tima_: 7tim A: [28457]

Details for d7tima_

PDB Entry: 7tim, 1.9 Å

PDB Description: structure of the triosephosphate isomerase-phosphoglycolohydroxamate complex: an analogue of the intermediate on the reaction pathway

PDB Compounds: (A:) triosephosphate isomerase

SCOP Domain Sequences for d7tima_:

Sequence; same for both SEQRES and ATOM records:

>d7tima_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

Timeline for d7tima_:

• d7tima_ first appeared (with stable ids) in SCOP 1.55
  
• d7tima_ appears in SCOP 1.71
  
• d7tima_ appears in SCOP 1.75
  
• d7tima_ appears in the current release, SCOPe 2.08