Lineage for d7tima_ (7tim A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18354Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 18355Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 18356Protein Triosephosphate isomerase [51353] (12 species)
  7. 18362Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (4 PDB entries)
  8. 18363Domain d7tima_: 7tim A: [28457]

Details for d7tima_

PDB Entry: 7tim (more details), 1.9 Å

PDB Description: structure of the triosephosphate isomerase-phosphoglycolohydroxamate complex: an analogue of the intermediate on the reaction pathway

SCOP Domain Sequences for d7tima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7tima_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae)}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

SCOP Domain Coordinates for d7tima_:

Click to download the PDB-style file with coordinates for d7tima_.
(The format of our PDB-style files is described here.)

Timeline for d7tima_:

View in 3D
Domains from other chains:
(mouse over for more information)
d7timb_