Lineage for d1htia_ (1hti A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (12 species) 
Species Human (Homo sapiens) [TaxId:9606] [51355] (1 PDB entry) 
Domain d1htia_: 1hti A: [28455]
Details for d1htia_
PDB Entry: 1hti (more details), 2.8 Å
PDB Description: crystal structure of recombinant human triosephosphate isomerase at 2.8 angstroms resolution. triosephosphate isomerase related human genetic disorders and comparison with the trypanosomal enzyme
SCOP Domain Sequences for d1htia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htia_ c.1.1.1 (A:) Triosephosphate isomerase {Human (Homo sapiens)}
apsrkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkia
vaaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeg
lgviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqq
aqevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpef
vdiinakq
SCOP Domain Coordinates for d1htia_:
Click to download the PDB-style file with coordinates for d1htia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1htia_:
- d1htia_ appears in SCOP 1.57
- d1htia_ appears in the current release, SCOPe 2.08
View in 3D
