Lineage for d1timb_ (1tim B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2089716Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2089717Protein Triosephosphate isomerase [51353] (20 species)
  7. 2089740Species Chicken (Gallus gallus) [TaxId:9031] [51354] (17 PDB entries)
    Uniprot P00940
  8. 2089774Domain d1timb_: 1tim B: [28454]

Details for d1timb_

PDB Entry: 1tim (more details), 2.5 Å

PDB Description: structure of triose phosphate isomerase from chicken muscle
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1timb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1timb_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
aprkffvggnwkmngkrkslgelihtldgaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfqetkaiadnvkdwskvvlayepvwaigtgktatpqqa
qevheklrgwlkthvsdavavqsriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh

SCOPe Domain Coordinates for d1timb_:

Click to download the PDB-style file with coordinates for d1timb_.
(The format of our PDB-style files is described here.)

Timeline for d1timb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tima_