Lineage for d1tima_ (1tim A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [51354] (8 PDB entries) 
Domain d1tima_: 1tim A: [28453]
Details for d1tima_
PDB Entry: 1tim (more details), 2.5 Å
PDB Description: structure of triose phosphate isomerase from chicken muscle
SCOP Domain Sequences for d1tima_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tima_ c.1.1.1 (A:) Triosephosphate isomerase {Chicken (Gallus gallus)}
aprkffvggnwkmngkrkslgelihtldgaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfqetkaiadnvkdwskvvlayepvwaigtgktatpqqa
qevheklrgwlkthvsdavavqsriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh
SCOP Domain Coordinates for d1tima_:
Click to download the PDB-style file with coordinates for d1tima_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tima_:
- d1tima_ first appeared (with stable ids) in SCOP 1.55
- d1tima_ appears in SCOP 1.59
- d1tima_ appears in SCOP 1.63
- d1tima_ appears in the current release, SCOPe 2.08
View in 3D
