Lineage for d8timb_ (8tim B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570218Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 570219Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 570220Protein Triosephosphate isomerase [51353] (17 species)
  7. 570253Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries)
  8. 570279Domain d8timb_: 8tim B: [28452]
    complexed with so4

Details for d8timb_

PDB Entry: 8tim (more details), 2.5 Å

PDB Description: triose phosphate isomerase

SCOP Domain Sequences for d8timb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8timb_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus)}
aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh

SCOP Domain Coordinates for d8timb_:

Click to download the PDB-style file with coordinates for d8timb_.
(The format of our PDB-style files is described here.)

Timeline for d8timb_: