Lineage for d8tima_ (8tim A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681099Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 681100Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 681101Protein Triosephosphate isomerase [51353] (17 species)
  7. 681131Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries)
  8. 681156Domain d8tima_: 8tim A: [28451]

Details for d8tima_

PDB Entry: 8tim (more details), 2.5 Å

PDB Description: triose phosphate isomerase
PDB Compounds: (A:) triose phosphate isomerase

SCOP Domain Sequences for d8tima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8tima_ c.1.1.1 (A:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh

SCOP Domain Coordinates for d8tima_:

Click to download the PDB-style file with coordinates for d8tima_.
(The format of our PDB-style files is described here.)

Timeline for d8tima_: