![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) ![]() |
![]() | Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) |
![]() | Protein Triosephosphate isomerase [51353] (17 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries) |
![]() | Domain d1tpwb_: 1tpw B: [28450] complexed with pgh; mutant |
PDB Entry: 1tpw (more details), 1.9 Å
SCOP Domain Sequences for d1tpwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tpwb_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus)} rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa qncykvpkgaftgeispamikdigaawvilghperrhvfgesdeligqkvahalaeglgv iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi inakh
Timeline for d1tpwb_: