Lineage for d1tpwa_ (1tpw A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681099Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 681100Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 681101Protein Triosephosphate isomerase [51353] (17 species)
  7. 681131Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries)
  8. 681148Domain d1tpwa_: 1tpw A: [28449]

Details for d1tpwa_

PDB Entry: 1tpw (more details), 1.9 Å

PDB Description: triosephosphate isomerase drinks water to keep healthy
PDB Compounds: (A:) triosephosphate isomerase

SCOP Domain Sequences for d1tpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpwa_ c.1.1.1 (A:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilghperrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh

SCOP Domain Coordinates for d1tpwa_:

Click to download the PDB-style file with coordinates for d1tpwa_.
(The format of our PDB-style files is described here.)

Timeline for d1tpwa_: