Lineage for d1tpwa_ (1tpw A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [51354] (8 PDB entries) 
Domain d1tpwa_: 1tpw A: [28449]
Details for d1tpwa_
PDB Entry: 1tpw (more details), 1.9 Å
PDB Description: triosephosphate isomerase drinks water to keep healthy
SCOP Domain Sequences for d1tpwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tpwa_ c.1.1.1 (A:) Triosephosphate isomerase {Chicken (Gallus gallus)}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilghperrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh
SCOP Domain Coordinates for d1tpwa_:
Click to download the PDB-style file with coordinates for d1tpwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tpwa_:
- d1tpwa_ first appeared (with stable ids) in SCOP 1.55
- d1tpwa_ appears in SCOP 1.57
- d1tpwa_ appears in SCOP 1.61
- d1tpwa_ appears in the current release, SCOPe 2.08
View in 3D
