Lineage for d1tpc2_ (1tpc 2:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143365Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1143366Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
  6. 1143367Protein Triosephosphate isomerase [51353] (21 species)
  7. 1143390Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries)
    Uniprot P00940
  8. 1143406Domain d1tpc2_: 1tpc 2: [28448]
    complexed with pgh

Details for d1tpc2_

PDB Entry: 1tpc (more details), 1.9 Å

PDB Description: offset of a catalytic lesion by a bound water soluble
PDB Compounds: (2:) triosephosphate isomerase

SCOPe Domain Sequences for d1tpc2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpc2_ c.1.1.1 (2:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilghperrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlaydpvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh

SCOPe Domain Coordinates for d1tpc2_:

Click to download the PDB-style file with coordinates for d1tpc2_.
(The format of our PDB-style files is described here.)

Timeline for d1tpc2_: