Lineage for d1tpva_ (1tpv A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473234Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 473235Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 473236Protein Triosephosphate isomerase [51353] (17 species)
  7. 473269Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries)
  8. 473288Domain d1tpva_: 1tpv A: [28443]

Details for d1tpva_

PDB Entry: 1tpv (more details), 1.9 Å

PDB Description: s96p change is a second-site suppressor for h95n sluggish mutant triosephosphate isomerase

SCOP Domain Sequences for d1tpva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpva_ c.1.1.1 (A:) Triosephosphate isomerase {Chicken (Gallus gallus)}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilgnperrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh

SCOP Domain Coordinates for d1tpva_:

Click to download the PDB-style file with coordinates for d1tpva_.
(The format of our PDB-style files is described here.)

Timeline for d1tpva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tpvb_