Lineage for d1tpub_ (1tpu B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 383643Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 383644Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 383645Protein Triosephosphate isomerase [51353] (16 species)
  7. 383678Species Chicken (Gallus gallus) [TaxId:9031] [51354] (8 PDB entries)
  8. 383688Domain d1tpub_: 1tpu B: [28442]
    complexed with pgh; mutant

Details for d1tpub_

PDB Entry: 1tpu (more details), 1.9 Å

PDB Description: s96p change is a second-site suppressor for h95n sluggish mutant triosephosphate isomerase

SCOP Domain Sequences for d1tpub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpub_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus)}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilgnserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh

SCOP Domain Coordinates for d1tpub_:

Click to download the PDB-style file with coordinates for d1tpub_.
(The format of our PDB-style files is described here.)

Timeline for d1tpub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tpua_