Lineage for d1tph2_ (1tph 2:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 235646Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 235647Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 235648Protein Triosephosphate isomerase [51353] (15 species)
  7. 235681Species Chicken (Gallus gallus) [TaxId:9031] [51354] (8 PDB entries)
  8. 235683Domain d1tph2_: 1tph 2: [28440]
    complexed with pgh

Details for d1tph2_

PDB Entry: 1tph (more details), 1.8 Å

PDB Description: 1.8 angstroms crystal structure of wild type chicken triosephosphate isomerase-phosphoglycolohydroxamate complex

SCOP Domain Sequences for d1tph2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tph2_ c.1.1.1 (2:) Triosephosphate isomerase {Chicken (Gallus gallus)}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh

SCOP Domain Coordinates for d1tph2_:

Click to download the PDB-style file with coordinates for d1tph2_.
(The format of our PDB-style files is described here.)

Timeline for d1tph2_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tph1_