Lineage for d1tph2_ (1tph 2:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (12 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [51354] (8 PDB entries) 
Domain d1tph2_: 1tph 2: [28440]
Details for d1tph2_
PDB Entry: 1tph (more details), 1.8 Å
PDB Description: 1.8 angstroms crystal structure of wild type chicken triosephosphate isomerase-phosphoglycolohydroxamate complex
SCOP Domain Sequences for d1tph2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tph2_ c.1.1.1 (2:) Triosephosphate isomerase {Chicken (Gallus gallus)}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh
SCOP Domain Coordinates for d1tph2_:
Click to download the PDB-style file with coordinates for d1tph2_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tph2_:
- d1tph2_ appears in SCOP 1.57
- d1tph2_ appears in the current release, SCOPe 2.08
View in 3D
