SCOP 1.55: Domain d1bsha2: 1bsh A:1-86

Lineage for d1bsha2 (1bsh A:1-86)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species)

7. Species Escherichia coli [TaxId:562] [51347] (3 PDB entries)

8. Domain d1bsha2: 1bsh A:1-86 [28437]
   Other proteins in same PDB: d1bsha1

Details for d1bsha2

PDB Entry: 1bsh

PDB Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex

SCOP Domain Sequences for d1bsha2:

Sequence; same for both SEQRES and ATOM records:

>d1bsha2 b.93.1.1 (A:1-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli}
amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
fiylsggilevqpgnvtvladtairg

Timeline for d1bsha2:

• d1bsha2 appears in SCOP 1.57
  
• d1bsha2 appears in the current release, SCOPe 2.08