SCOPe 2.07: Domain d1bsna2: 1bsn A:1-86

Lineage for d1bsna2 (1bsn A:1-86)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
   delta subunit in mitochondria

7. Species Escherichia coli [TaxId:562] [51347] (4 PDB entries)

8. Domain d1bsna2: 1bsn A:1-86 [28436]
   Other proteins in same PDB: d1bsna1

Details for d1bsna2

PDB Entry: 1bsn

PDB Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex

PDB Compounds: (A:) protein (epsilon subunit)

SCOPe Domain Sequences for d1bsna2:

Sequence; same for both SEQRES and ATOM records:

>d1bsna2 b.93.1.1 (A:1-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]}
amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
fiylsggilevqpgnvtvladtairg

Timeline for d1bsna2:

• d1bsna2 first appeared (with stable ids) in SCOP 1.55
  
• d1bsna2 appears in SCOPe 2.06
  
• d1bsna2 appears in the current release, SCOPe 2.08