![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily) |
![]() | Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) ![]() |
![]() | Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein) |
![]() | Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [51347] (4 PDB entries) |
![]() | Domain d1bsna2: 1bsn A:1-86 [28436] Other proteins in same PDB: d1bsna1 |
PDB Entry: 1bsn (more details)
SCOP Domain Sequences for d1bsna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsna2 b.93.1.1 (A:1-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli} amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee fiylsggilevqpgnvtvladtairg
Timeline for d1bsna2: