Lineage for d1bsna2 (1bsn A:1-86)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115743Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
  4. 115744Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 115745Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein)
  6. 115746Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species)
  7. 115750Species Escherichia coli [TaxId:562] [51347] (4 PDB entries)
  8. 115752Domain d1bsna2: 1bsn A:1-86 [28436]
    Other proteins in same PDB: d1bsna1

Details for d1bsna2

PDB Entry: 1bsn (more details)

PDB Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex

SCOP Domain Sequences for d1bsna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsna2 b.93.1.1 (A:1-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli}
amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
fiylsggilevqpgnvtvladtairg

SCOP Domain Coordinates for d1bsna2:

Click to download the PDB-style file with coordinates for d1bsna2.
(The format of our PDB-style files is described here.)

Timeline for d1bsna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bsna1