Lineage for d1bsna2 (1bsn A:1-86)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073725Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 2073726Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 2073727Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 protein domains)
  6. 2073728Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
    delta subunit in mitochondria
  7. 2073743Species Escherichia coli [TaxId:562] [51347] (4 PDB entries)
  8. 2073745Domain d1bsna2: 1bsn A:1-86 [28436]
    Other proteins in same PDB: d1bsna1

Details for d1bsna2

PDB Entry: 1bsn (more details)

PDB Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
PDB Compounds: (A:) protein (epsilon subunit)

SCOPe Domain Sequences for d1bsna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsna2 b.93.1.1 (A:1-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]}
amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
fiylsggilevqpgnvtvladtairg

SCOPe Domain Coordinates for d1bsna2:

Click to download the PDB-style file with coordinates for d1bsna2.
(The format of our PDB-style files is described here.)

Timeline for d1bsna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bsna1