SCOP 1.59: Domain d1aqt_2: 1aqt 2-86

Lineage for d1aqt_2 (1aqt 2-86)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species)

7. Species Escherichia coli [TaxId:562] [51347] (4 PDB entries)

8. Domain d1aqt_2: 1aqt 2-86 [28435]
   Other proteins in same PDB: d1aqt_1

Details for d1aqt_2

PDB Entry: 1aqt, 2.3 Å

PDB Description: epsilon subunit of f1f0-atp synthase from escherichia coli

SCOP Domain Sequences for d1aqt_2:

Sequence; same for both SEQRES and ATOM records:

>d1aqt_2 b.93.1.1 (2-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli}
styhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhgheef
iylsggilevqpgnvtvladtairg

Timeline for d1aqt_2:

• d1aqt_2 first appeared (with stable ids) in SCOP 1.55
  
• d1aqt_2 appears in SCOP 1.57
  
• d1aqt_2 appears in SCOP 1.61
  
• d1aqt_2 appears in the current release, SCOPe 2.08, called d1aqta2