Lineage for d1aqt_2 (1aqt 2-86)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 64196Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
  4. 64197Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 64198Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein)
  6. 64199Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species)
  7. 64203Species Escherichia coli [TaxId:562] [51347] (4 PDB entries)
  8. 64204Domain d1aqt_2: 1aqt 2-86 [28435]
    Other proteins in same PDB: d1aqt_1

Details for d1aqt_2

PDB Entry: 1aqt (more details), 2.3 Å

PDB Description: epsilon subunit of f1f0-atp synthase from escherichia coli

SCOP Domain Sequences for d1aqt_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqt_2 b.93.1.1 (2-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli}
styhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhgheef
iylsggilevqpgnvtvladtairg

SCOP Domain Coordinates for d1aqt_2:

Click to download the PDB-style file with coordinates for d1aqt_2.
(The format of our PDB-style files is described here.)

Timeline for d1aqt_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqt_1