SCOPe 2.08: Domain d1aqta2: 1aqt A:2-86

Lineage for d1aqta2 (1aqt A:2-86)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
   delta subunit in mitochondria

7. Species Escherichia coli [TaxId:562] [51347] (4 PDB entries)

8. Domain d1aqta2: 1aqt A:2-86 [28435]
   Other proteins in same PDB: d1aqta1

Details for d1aqta2

PDB Entry: 1aqt, 2.3 Å

PDB Description: epsilon subunit of f1f0-atp synthase from escherichia coli

PDB Compounds: (A:) ATP synthase

SCOPe Domain Sequences for d1aqta2:

Sequence; same for both SEQRES and ATOM records:

>d1aqta2 b.93.1.1 (A:2-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]}
styhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhgheef
iylsggilevqpgnvtvladtairg

Timeline for d1aqta2:

• d1aqta2 first appeared (with stable ids) in SCOP 1.55, called d1aqt_2
  
• d1aqta2 appears in SCOPe 2.07