SCOP 1.73: Domain d3ubpc1: 3ubp C:1-131,C:435-483

Lineage for d3ubpc1 (3ubp C:1-131,C:435-483)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (8 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (3 species)

7. Species Bacillus pasteurii [TaxId:1474] [51342] (6 PDB entries)

8. Domain d3ubpc1: 3ubp C:1-131,C:435-483 [28434]
   Other proteins in same PDB: d3ubpa_, d3ubpb_, d3ubpc2

Details for d3ubpc1

PDB Entry: 3ubp, 2 Å

PDB Description: diamidophosphate inhibited bacillus pasteurii urease

PDB Compounds: (C:) protein (urease alpha subunit)

SCOP Domain Sequences for d3ubpc1:

Sequence; same for both SEQRES and ATOM records:

>d3ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

Timeline for d3ubpc1:

• d3ubpc1 first appeared (with stable ids) in SCOP 1.55
  
• d3ubpc1 appears in SCOP 1.71
  
• d3ubpc1 appears in SCOP 1.75
  
• d3ubpc1 appears in the current release, SCOPe 2.08