Lineage for d3ubpc1 (3ubp C:1-131,C:435-483)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471748Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 471749Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 471750Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 471751Protein alpha-Subunit of urease [51340] (3 species)
  7. 471752Species Bacillus pasteurii [TaxId:1474] [51342] (6 PDB entries)
  8. 471757Domain d3ubpc1: 3ubp C:1-131,C:435-483 [28434]
    Other proteins in same PDB: d3ubpa_, d3ubpb_, d3ubpc2

Details for d3ubpc1

PDB Entry: 3ubp (more details), 2 Å

PDB Description: diamidophosphate inhibited bacillus pasteurii urease

SCOP Domain Sequences for d3ubpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

SCOP Domain Coordinates for d3ubpc1:

Click to download the PDB-style file with coordinates for d3ubpc1.
(The format of our PDB-style files is described here.)

Timeline for d3ubpc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ubpc2