![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.92: alpha-Subunit of urease, composite domain [51337] (1 superfamily) |
![]() | Superfamily b.92.1: alpha-Subunit of urease, composite domain [51338] (1 family) ![]() |
![]() | Family b.92.1.1: alpha-Subunit of urease, composite domain [51339] (1 protein) |
![]() | Protein alpha-Subunit of urease, composite domain [51340] (2 species) |
![]() | Species Bacillus pasteurii [TaxId:1474] [51342] (4 PDB entries) |
![]() | Domain d3ubpc1: 3ubp C:1-131,C:435-483 [28434] Other proteins in same PDB: d3ubpa_, d3ubpb_, d3ubpc2 |
PDB Entry: 3ubp (more details), 2 Å
SCOP Domain Sequences for d3ubpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease, composite domain {Bacillus pasteurii} mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt v
Timeline for d3ubpc1: