Lineage for d3ubpc1 (3ubp C:1-131,C:435-483)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18307Fold b.92: alpha-Subunit of urease, composite domain [51337] (1 superfamily)
  4. 18308Superfamily b.92.1: alpha-Subunit of urease, composite domain [51338] (1 family) (S)
  5. 18309Family b.92.1.1: alpha-Subunit of urease, composite domain [51339] (1 protein)
  6. 18310Protein alpha-Subunit of urease, composite domain [51340] (2 species)
  7. 18311Species Bacillus pasteurii [TaxId:1474] [51342] (4 PDB entries)
  8. 18315Domain d3ubpc1: 3ubp C:1-131,C:435-483 [28434]
    Other proteins in same PDB: d3ubpa_, d3ubpb_, d3ubpc2

Details for d3ubpc1

PDB Entry: 3ubp (more details), 2 Å

PDB Description: diamidophosphate inhibited bacillus pasteurii urease

SCOP Domain Sequences for d3ubpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease, composite domain {Bacillus pasteurii}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

SCOP Domain Coordinates for d3ubpc1:

Click to download the PDB-style file with coordinates for d3ubpc1.
(The format of our PDB-style files is described here.)

Timeline for d3ubpc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ubpc2