SCOPe 2.07: Domain d2ubpc1: 2ubp C:1-131,C:435-483

Lineage for d2ubpc1 (2ubp C:1-131,C:435-483)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries)

8. Domain d2ubpc1: 2ubp C:1-131,C:435-483 [28433]
   Other proteins in same PDB: d2ubpa_, d2ubpb_, d2ubpc2
   complexed with ni, so4

Details for d2ubpc1

PDB Entry: 2ubp, 2 Å

PDB Description: structure of native urease from bacillus pasteurii

PDB Compounds: (C:) protein (urease alpha subunit)

SCOPe Domain Sequences for d2ubpc1:

Sequence; same for both SEQRES and ATOM records:

>d2ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

Timeline for d2ubpc1:

• d2ubpc1 first appeared (with stable ids) in SCOP 1.55
  
• d2ubpc1 appears in SCOPe 2.06
  
• d2ubpc1 appears in the current release, SCOPe 2.08