SCOP 1.57: Domain d2ubpc1: 2ubp C:1-131,C:435-483

Lineage for d2ubpc1 (2ubp C:1-131,C:435-483)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.92: alpha-Subunit of urease, composite domain [51337] (1 superfamily)

4. Superfamily b.92.1: alpha-Subunit of urease, composite domain [51338] (1 family)

5. Family b.92.1.1: alpha-Subunit of urease, composite domain [51339] (1 protein)

6. Protein alpha-Subunit of urease, composite domain [51340] (2 species)

7. Species Bacillus pasteurii [TaxId:1474] [51342] (5 PDB entries)

8. Domain d2ubpc1: 2ubp C:1-131,C:435-483 [28433]
   Other proteins in same PDB: d2ubpa_, d2ubpb_, d2ubpc2

Details for d2ubpc1

PDB Entry: 2ubp, 2 Å

PDB Description: structure of native urease from bacillus pasteurii

SCOP Domain Sequences for d2ubpc1:

Sequence; same for both SEQRES and ATOM records:

>d2ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease, composite domain {Bacillus pasteurii}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

Timeline for d2ubpc1:

• d2ubpc1 first appeared (with stable ids) in SCOP 1.55
  
• d2ubpc1 appears in SCOP 1.59
  
• d2ubpc1 appears in the current release, SCOPe 2.08