![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein) |
![]() | Protein alpha-Subunit of urease [51340] (4 species) |
![]() | Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries) |
![]() | Domain d1ubpc1: 1ubp C:1-131,C:435-483 [28432] Other proteins in same PDB: d1ubpa_, d1ubpb_, d1ubpc2 complexed with bme, ni |
PDB Entry: 1ubp (more details), 1.65 Å
SCOPe Domain Sequences for d1ubpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]} mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt v
Timeline for d1ubpc1: