Lineage for d1ubpc1 (1ubp C:1-131,C:435-483)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568555Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 568556Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 568557Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 568558Protein alpha-Subunit of urease [51340] (3 species)
  7. 568559Species Bacillus pasteurii [TaxId:1474] [51342] (6 PDB entries)
  8. 568561Domain d1ubpc1: 1ubp C:1-131,C:435-483 [28432]
    Other proteins in same PDB: d1ubpa_, d1ubpb_, d1ubpc2
    complexed with bme, cbx, ni

Details for d1ubpc1

PDB Entry: 1ubp (more details), 1.65 Å

PDB Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution

SCOP Domain Sequences for d1ubpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

SCOP Domain Coordinates for d1ubpc1:

Click to download the PDB-style file with coordinates for d1ubpc1.
(The format of our PDB-style files is described here.)

Timeline for d1ubpc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ubpc2