| Class b: All beta proteins [48724] (178 folds) |
| Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
| Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein) |
| Protein alpha-Subunit of urease [51340] (4 species) |
| Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries) |
| Domain d4ubpc1: 4ubp C:1-131,C:435-483 [28431] Other proteins in same PDB: d4ubpa_, d4ubpb_, d4ubpc2 complexed with hae, ni |
PDB Entry: 4ubp (more details), 1.55 Å
SCOPe Domain Sequences for d4ubpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v
Timeline for d4ubpc1: