Class b: All beta proteins [48724] (149 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein) |
Protein alpha-Subunit of urease [51340] (3 species) |
Species Bacillus pasteurii [TaxId:1474] [51342] (6 PDB entries) |
Domain d4ubpc1: 4ubp C:1-131,C:435-483 [28431] Other proteins in same PDB: d4ubpa_, d4ubpb_, d4ubpc2 complexed with ace, hae, ni |
PDB Entry: 4ubp (more details), 1.55 Å
SCOP Domain Sequences for d4ubpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii} mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt v
Timeline for d4ubpc1: