SCOP 1.61: Domain d4ubpc1: 4ubp C:1-131,C:435-483

Lineage for d4ubpc1 (4ubp C:1-131,C:435-483)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (3 families)

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (3 species)

7. Species Bacillus pasteurii [TaxId:1474] [51342] (5 PDB entries)

8. Domain d4ubpc1: 4ubp C:1-131,C:435-483 [28431]
   Other proteins in same PDB: d4ubpa_, d4ubpb_, d4ubpc2

Details for d4ubpc1

PDB Entry: 4ubp, 1.55 Å

PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution

SCOP Domain Sequences for d4ubpc1:

Sequence; same for both SEQRES and ATOM records:

>d4ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

Timeline for d4ubpc1:

• d4ubpc1 first appeared (with stable ids) in SCOP 1.55
  
• d4ubpc1 appears in SCOP 1.59
  
• d4ubpc1 appears in SCOP 1.63
  
• d4ubpc1 appears in the current release, SCOPe 2.08