Lineage for d4ubpc1 (4ubp C:1-131,C:435-483)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172428Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
  4. 172429Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (3 families) (S)
  5. 172430Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 172431Protein alpha-Subunit of urease [51340] (3 species)
  7. 172432Species Bacillus pasteurii [TaxId:1474] [51342] (5 PDB entries)
  8. 172433Domain d4ubpc1: 4ubp C:1-131,C:435-483 [28431]
    Other proteins in same PDB: d4ubpa_, d4ubpb_, d4ubpc2

Details for d4ubpc1

PDB Entry: 4ubp (more details), 1.55 Å

PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution

SCOP Domain Sequences for d4ubpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

SCOP Domain Coordinates for d4ubpc1:

Click to download the PDB-style file with coordinates for d4ubpc1.
(The format of our PDB-style files is described here.)

Timeline for d4ubpc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ubpc2