SCOP 1.57: Domain d1ef2a1: 1ef2 A:1002-1129,A:1423-1475

Lineage for d1ef2a1 (1ef2 A:1002-1129,A:1423-1475)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.92: alpha-Subunit of urease, composite domain [51337] (1 superfamily)

4. Superfamily b.92.1: alpha-Subunit of urease, composite domain [51338] (1 family)

5. Family b.92.1.1: alpha-Subunit of urease, composite domain [51339] (1 protein)

6. Protein alpha-Subunit of urease, composite domain [51340] (2 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51341] (25 PDB entries)

8. Domain d1ef2a1: 1ef2 A:1002-1129,A:1423-1475 [28429]
   Other proteins in same PDB: d1ef2a2, d1ef2b_, d1ef2c_

Details for d1ef2a1

PDB Entry: 1ef2, 2.5 Å

PDB Description: crystal structure of manganese-substituted klebsiella aerogenes urease

PDB Compounds: (A:)

SCOP Domain Sequences for d1ef2a1:

Sequence; same for both SEQRES and ATOM records:

>d1ef2a1 b.92.1.1 (A:1002-1129,A:1423-1475) alpha-Subunit of urease, composite domain {Klebsiella aerogenes}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

Timeline for d1ef2a1:

• d1ef2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ef2a1 appears in SCOP 1.59
  
• d1ef2a1 appears in the current release, SCOPe 2.07