Lineage for d1ef2a1 (1ef2 A:1002-1129,A:1423-1475)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 64160Fold b.92: alpha-Subunit of urease, composite domain [51337] (1 superfamily)
  4. 64161Superfamily b.92.1: alpha-Subunit of urease, composite domain [51338] (1 family) (S)
  5. 64162Family b.92.1.1: alpha-Subunit of urease, composite domain [51339] (1 protein)
  6. 64163Protein alpha-Subunit of urease, composite domain [51340] (2 species)
  7. 64170Species Klebsiella aerogenes [TaxId:28451] [51341] (25 PDB entries)
  8. 64192Domain d1ef2a1: 1ef2 A:1002-1129,A:1423-1475 [28429]
    Other proteins in same PDB: d1ef2a2, d1ef2b_, d1ef2c_

Details for d1ef2a1

PDB Entry: 1ef2 (more details), 2.5 Å

PDB Description: crystal structure of manganese-substituted klebsiella aerogenes urease
PDB Compounds: (A:)

SCOP Domain Sequences for d1ef2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef2a1 b.92.1.1 (A:1002-1129,A:1423-1475) alpha-Subunit of urease, composite domain {Klebsiella aerogenes}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

SCOP Domain Coordinates for d1ef2a1:

Click to download the PDB-style file with coordinates for d1ef2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ef2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ef2a2