Lineage for d1a5lc1 (1a5l C:2-129,C:423-475)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084271Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2084272Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2084273Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 2084274Protein alpha-Subunit of urease [51340] (4 species)
  7. 2084293Species Klebsiella aerogenes [TaxId:28451] [51341] (28 PDB entries)
  8. 2084313Domain d1a5lc1: 1a5l C:2-129,C:423-475 [28426]
    Other proteins in same PDB: d1a5la_, d1a5lb_, d1a5lc2

Details for d1a5lc1

PDB Entry: 1a5l (more details), 2.2 Å

PDB Description: k217c variant of klebsiella aerogenes urease
PDB Compounds: (C:) urease (alpha subunit)

SCOPe Domain Sequences for d1a5lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5lc1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

SCOPe Domain Coordinates for d1a5lc1:

Click to download the PDB-style file with coordinates for d1a5lc1.
(The format of our PDB-style files is described here.)

Timeline for d1a5lc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5lc2