SCOPe 2.08: Domain d1ejrc1: 1ejr C:1002-1129,C:1423-1475

Lineage for d1ejrc1 (1ejr C:1002-1129,C:1423-1475)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51341] (28 PDB entries)

8. Domain d1ejrc1: 1ejr C:1002-1129,C:1423-1475 [28420]
   Other proteins in same PDB: d1ejra_, d1ejrb_, d1ejrc2
   complexed with ni

Details for d1ejrc1

PDB Entry: 1ejr, 2 Å

PDB Description: crystal structure of the d221a variant of klebsiella aerogenes urease

PDB Compounds: (C:) urease alpha subunit

SCOPe Domain Sequences for d1ejrc1:

Sequence; same for both SEQRES and ATOM records:

>d1ejrc1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

Timeline for d1ejrc1:

• d1ejrc1 first appeared (with stable ids) in SCOP 1.55
  
• d1ejrc1 appears in SCOPe 2.07