SCOPe 2.02: Domain d1fwec1: 1fwe C:2-129,C:423-475

Lineage for d1fwec1 (1fwe C:2-129,C:423-475)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (3 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51341] (27 PDB entries)

8. Domain d1fwec1: 1fwe C:2-129,C:423-475 [28415]
   Other proteins in same PDB: d1fwea_, d1fweb_, d1fwec2
   complexed with hae, ni

Details for d1fwec1

PDB Entry: 1fwe, 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant with acetohydroxamic acid (aha) bound

PDB Compounds: (C:) urease

SCOPe Domain Sequences for d1fwec1:

Sequence; same for both SEQRES and ATOM records:

>d1fwec1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

Timeline for d1fwec1:

• d1fwec1 first appeared (with stable ids) in SCOP 1.55
  
• d1fwec1 appears in SCOPe 2.01
  
• d1fwec1 appears in SCOPe 2.03
  
• d1fwec1 appears in the current release, SCOPe 2.08