SCOP 1.65: Domain d1fwhc1: 1fwh C:2-129,C:423-475

Lineage for d1fwhc1 (1fwh C:2-129,C:423-475)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (3 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51341] (26 PDB entries)

8. Domain d1fwhc1: 1fwh C:2-129,C:423-475 [28414]
   Other proteins in same PDB: d1fwha_, d1fwhb_, d1fwhc2
   complexed with ni; mutant

Details for d1fwhc1

PDB Entry: 1fwh, 2 Å

PDB Description: klebsiella aerogenes urease, c319y variant

SCOP Domain Sequences for d1fwhc1:

Sequence; same for both SEQRES and ATOM records:

>d1fwhc1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease {Klebsiella aerogenes}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

Timeline for d1fwhc1:

• d1fwhc1 first appeared (with stable ids) in SCOP 1.55
  
• d1fwhc1 appears in SCOP 1.63
  
• d1fwhc1 appears in SCOP 1.67
  
• d1fwhc1 appears in the current release, SCOPe 2.08