Lineage for d1fwbc1 (1fwb C:2-129,C:423-475)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471748Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 471749Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 471750Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 471751Protein alpha-Subunit of urease [51340] (3 species)
  7. 471762Species Klebsiella aerogenes [TaxId:28451] [51341] (27 PDB entries)
  8. 471766Domain d1fwbc1: 1fwb C:2-129,C:423-475 [28409]
    Other proteins in same PDB: d1fwba_, d1fwbb_, d1fwbc2

Details for d1fwbc1

PDB Entry: 1fwb (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 6.5

SCOP Domain Sequences for d1fwbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwbc1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease {Klebsiella aerogenes}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

SCOP Domain Coordinates for d1fwbc1:

Click to download the PDB-style file with coordinates for d1fwbc1.
(The format of our PDB-style files is described here.)

Timeline for d1fwbc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fwbc2