SCOP 1.69: Domain d1fwac1: 1fwa C:2-129,C:423-475

Lineage for d1fwac1 (1fwa C:2-129,C:423-475)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)

6. Protein alpha-Subunit of urease [51340] (3 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51341] (27 PDB entries)

8. Domain d1fwac1: 1fwa C:2-129,C:423-475 [28408]
   Other proteins in same PDB: d1fwaa_, d1fwab_, d1fwac2

Details for d1fwac1

PDB Entry: 1fwa, 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 7.5

SCOP Domain Sequences for d1fwac1:

Sequence; same for both SEQRES and ATOM records:

>d1fwac1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease {Klebsiella aerogenes}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

Timeline for d1fwac1:

• d1fwac1 first appeared (with stable ids) in SCOP 1.55
  
• d1fwac1 appears in SCOP 1.67
  
• d1fwac1 appears in SCOP 1.71
  
• d1fwac1 appears in the current release, SCOPe 2.08