Lineage for d1dtoa_ (1dto A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810331Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily)
    complex fold made of bifurcated and coiled beta-sheets
  4. 1810332Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families) (S)
    automatically mapped to Pfam PF00508
  5. 1810333Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein)
  6. 1810334Protein E2 regulatory, transactivation domain [51334] (3 species)
  7. 1810338Species Human papillomavirus type 16 [TaxId:333760] [51336] (2 PDB entries)
  8. 1810340Domain d1dtoa_: 1dto A: [28405]
    contains additional N-terminal (sub)domain; alpha-hairpin

Details for d1dtoa_

PDB Entry: 1dto (more details), 1.9 Å

PDB Description: crystal structure of the complete transactivation domain of e2 protein from the human papillomavirus type 16
PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1dtoa_:

Sequence, based on SEQRES records: (download)

>d1dtoa_ b.91.1.1 (A:) E2 regulatory, transactivation domain {Human papillomavirus type 16 [TaxId: 333760]}
hmetlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinhqvv
ptlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgytvev
qfdgdicntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddaekys
knkvwevhaggqvilcptsvfs

Sequence, based on observed residues (ATOM records): (download)

>d1dtoa_ b.91.1.1 (A:) E2 regulatory, transactivation domain {Human papillomavirus type 16 [TaxId: 333760]}
hmetlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinhqvv
ptlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgytvev
qfdgdntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddaekyskn
kvwevhaggqvilcptsvfs

SCOPe Domain Coordinates for d1dtoa_:

Click to download the PDB-style file with coordinates for d1dtoa_.
(The format of our PDB-style files is described here.)

Timeline for d1dtoa_: