Lineage for d1lktd_ (1lkt D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073428Fold b.90: Head-binding domain of phage P22 tailspike protein [51326] (1 superfamily)
    complex fold made of bifurcated and partly folded beta-sheet
  4. 2073429Superfamily b.90.1: Head-binding domain of phage P22 tailspike protein [51327] (1 family) (S)
    automatically mapped to Pfam PF09008
  5. 2073430Family b.90.1.1: Head-binding domain of phage P22 tailspike protein [51328] (1 protein)
  6. 2073431Protein Head-binding domain of phage P22 tailspike protein [51329] (1 species)
  7. 2073432Species Salmonella bacteriophage P22 [TaxId:10754] [51330] (1 PDB entry)
  8. 2073436Domain d1lktd_: 1lkt D: [28401]

Details for d1lktd_

PDB Entry: 1lkt (more details), 2.6 Å

PDB Description: crystal structure of the head-binding domain of phage p22 tailspike protein
PDB Compounds: (D:) tailspike protein

SCOPe Domain Sequences for d1lktd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lktd_ b.90.1.1 (D:) Head-binding domain of phage P22 tailspike protein {Salmonella bacteriophage P22 [TaxId: 10754]}
anvvvsnprpiftesrsfkavangkiyigqidtdpvnpanqipvyienedgshvqitqpl
iinaagkivyngqlvkivtvqghsmaiydangsqvdyianvlky

SCOPe Domain Coordinates for d1lktd_:

Click to download the PDB-style file with coordinates for d1lktd_.
(The format of our PDB-style files is described here.)

Timeline for d1lktd_: