SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1lktd_ (1lkt D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073428Fold b.90: Head-binding domain of phage P22 tailspike protein [51326] (1 superfamily)
    complex fold made of bifurcated and partly folded beta-sheet
  4. 2073429Superfamily b.90.1: Head-binding domain of phage P22 tailspike protein [51327] (1 family) (S)
    automatically mapped to Pfam PF09008
  5. 2073430Family b.90.1.1: Head-binding domain of phage P22 tailspike protein [51328] (1 protein)
  6. 2073431Protein Head-binding domain of phage P22 tailspike protein [51329] (1 species)
  7. 2073432Species Salmonella bacteriophage P22 [TaxId:10754] [51330] (1 PDB entry)
  8. 2073436Domain d1lktd_: 1lkt D: [28401]

Details for d1lktd_

PDB Entry: 1lkt (more details), 2.6 Å

PDB Description: crystal structure of the head-binding domain of phage p22 tailspike protein
PDB Compounds: (D:) tailspike protein

SCOPe Domain Sequences for d1lktd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lktd_ b.90.1.1 (D:) Head-binding domain of phage P22 tailspike protein {Salmonella bacteriophage P22 [TaxId: 10754]}
anvvvsnprpiftesrsfkavangkiyigqidtdpvnpanqipvyienedgshvqitqpl
iinaagkivyngqlvkivtvqghsmaiydangsqvdyianvlky

SCOPe Domain Coordinates for d1lktd_:

Click to download the PDB-style file with coordinates for d1lktd_.
(The format of our PDB-style files is described here.)

Timeline for d1lktd_: