SCOPe 2.06: Domain d1lktc_: 1lkt C:

Lineage for d1lktc_ (1lkt C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.90: Head-binding domain of phage P22 tailspike protein [51326] (1 superfamily)
   complex fold made of bifurcated and partly folded beta-sheet

4. Superfamily b.90.1: Head-binding domain of phage P22 tailspike protein [51327] (1 family)
   automatically mapped to Pfam PF09008

5. Family b.90.1.1: Head-binding domain of phage P22 tailspike protein [51328] (1 protein)

6. Protein Head-binding domain of phage P22 tailspike protein [51329] (1 species)

7. Species Salmonella bacteriophage P22 [TaxId:10754] [51330] (1 PDB entry)

8. Domain d1lktc_: 1lkt C: [28400]

Details for d1lktc_

PDB Entry: 1lkt, 2.6 Å

PDB Description: crystal structure of the head-binding domain of phage p22 tailspike protein

PDB Compounds: (C:) tailspike protein

SCOPe Domain Sequences for d1lktc_:

Sequence; same for both SEQRES and ATOM records:

>d1lktc_ b.90.1.1 (C:) Head-binding domain of phage P22 tailspike protein {Salmonella bacteriophage P22 [TaxId: 10754]}
anvvvsnprpiftesrsfkavangkiyigqidtdpvnpanqipvyienedgshvqitqpl
iinaagkivyngqlvkivtvqghsmaiydangsqvdyianvlky

Timeline for d1lktc_:

• d1lktc_ first appeared (with stable ids) in SCOP 1.55
  
• d1lktc_ appears in SCOPe 2.05
  
• d1lktc_ appears in SCOPe 2.07
  
• d1lktc_ appears in the current release, SCOPe 2.08