Lineage for d2ezma_ (2ezm A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084166Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 2084167Superfamily b.89.1: Cyanovirin-N [51322] (2 families) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
    automatically mapped to Pfam PF08881
  5. 2084168Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)
  6. 2084169Protein Cyanovirin-N [51324] (1 species)
  7. 2084170Species Nostoc ellipsosporum [TaxId:45916] [51325] (18 PDB entries)
  8. 2084205Domain d2ezma_: 2ezm A: [28396]
    CASP3

Details for d2ezma_

PDB Entry: 2ezm (more details)

PDB Description: solution nmr structure of cyanovirin-n, restrained regularized mean coordinates
PDB Compounds: (A:) Cyanovirin-N

SCOPe Domain Sequences for d2ezma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezma_ b.89.1.1 (A:) Cyanovirin-N {Nostoc ellipsosporum [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqpsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

SCOPe Domain Coordinates for d2ezma_:

Click to download the PDB-style file with coordinates for d2ezma_.
(The format of our PDB-style files is described here.)

Timeline for d2ezma_: