Lineage for d1fwqa_ (1fwq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428233Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2428234Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2428235Family b.88.1.1: RabGEF Mss4 [51317] (1 protein)
    contains zinc-binding site
    automatically mapped to Pfam PF04421
  6. 2428236Protein RabGEF Mss4 [51318] (2 species)
  7. 2428237Species Human (Homo sapiens) [TaxId:9606] [51320] (2 PDB entries)
  8. 2428240Domain d1fwqa_: 1fwq A: [28394]
    complexed with zn

Details for d1fwqa_

PDB Entry: 1fwq (more details)

PDB Description: solution structure of human mss4, a guanine nucleotide exchange factor for rab proteins
PDB Compounds: (A:) guanine nucleotide exchange factor

SCOPe Domain Sequences for d1fwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwqa_ b.88.1.1 (A:) RabGEF Mss4 {Human (Homo sapiens) [TaxId: 9606]}
elvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpalsdgsnpdgdllqeh
wlvedmfifenvgftkdvgnikflvcadceigpigwhclddknsfyvalervshe

SCOPe Domain Coordinates for d1fwqa_:

Click to download the PDB-style file with coordinates for d1fwqa_.
(The format of our PDB-style files is described here.)

Timeline for d1fwqa_: