SCOPe 2.06: Domain d1fwqa_: 1fwq A:

Lineage for d1fwqa_ (1fwq A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.1: RabGEF Mss4 [51317] (1 protein)
   contains zinc-binding site
   automatically mapped to Pfam PF04421

6. Protein RabGEF Mss4 [51318] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51320] (2 PDB entries)

8. Domain d1fwqa_: 1fwq A: [28394]
   complexed with zn

Details for d1fwqa_

PDB Entry: 1fwq

PDB Description: solution structure of human mss4, a guanine nucleotide exchange factor for rab proteins

PDB Compounds: (A:) guanine nucleotide exchange factor

SCOPe Domain Sequences for d1fwqa_:

Sequence; same for both SEQRES and ATOM records:

>d1fwqa_ b.88.1.1 (A:) RabGEF Mss4 {Human (Homo sapiens) [TaxId: 9606]}
elvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpalsdgsnpdgdllqeh
wlvedmfifenvgftkdvgnikflvcadceigpigwhclddknsfyvalervshe

Timeline for d1fwqa_:

• d1fwqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fwqa_ appears in SCOPe 2.05
  
• d1fwqa_ appears in SCOPe 2.07
  
• d1fwqa_ appears in the current release, SCOPe 2.08