![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.1: Mss4-like [51316] (5 families) ![]() duplication: tandem repeat of two similar structural motifs |
![]() | Family b.88.1.1: RabGEF Mss4 [51317] (1 protein) contains zinc-binding site automatically mapped to Pfam PF04421 |
![]() | Protein RabGEF Mss4 [51318] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [51319] (1 PDB entry) |
![]() | Domain d1hxrb_: 1hxr B: [28393] complexed with zn |
PDB Entry: 1hxr (more details), 1.65 Å
SCOPe Domain Sequences for d1hxrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxrb_ b.88.1.1 (B:) RabGEF Mss4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} elvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpdlvdgsnpdgdvleeh wlvndmfifenvgftkdvgnvkflvcadceigpigwhclddknsfyvalervshe
Timeline for d1hxrb_: