SCOPe 2.07: Domain d1hxrb_: 1hxr B:

Lineage for d1hxrb_ (1hxr B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.1: RabGEF Mss4 [51317] (1 protein)
   contains zinc-binding site
   automatically mapped to Pfam PF04421

6. Protein RabGEF Mss4 [51318] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [51319] (1 PDB entry)

8. Domain d1hxrb_: 1hxr B: [28393]
   complexed with zn

Details for d1hxrb_

PDB Entry: 1hxr, 1.65 Å

PDB Description: crystal structure of mss4 at 1.65 angstroms

PDB Compounds: (B:) Guanine nucleotide exchange factor MSS4

SCOPe Domain Sequences for d1hxrb_:

Sequence; same for both SEQRES and ATOM records:

>d1hxrb_ b.88.1.1 (B:) RabGEF Mss4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
elvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpdlvdgsnpdgdvleeh
wlvndmfifenvgftkdvgnvkflvcadceigpigwhclddknsfyvalervshe

Timeline for d1hxrb_:

• d1hxrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hxrb_ appears in SCOPe 2.06